PCBD1 Fragment MS Protein Standard

Product Information
Protein Name
Pterin-4-alpha-carbinolamine dehydratase
Symbol
PCBD1
Synonyms
4-alpha-hydroxy-tetrahydropterin dehydratase, Dimerization cofactor of hepatocyte nuclear factor 1-alpha, Phenylalanine hydroxylase-stimulating protein, Pterin carbinolamine dehydratase
Uniprot ID
P61457
Description
PCBD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PCBD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket