UBASH3A Fragment MS Protein Standard

Ubiquitin-associated and SH3 domain-containing protein A

UBASH3A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBASH3A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UBASH3A

Cbl-interacting protein 4, Suppressor of T-cell receptor signaling 2, T-cell ubiquitin ligand 1

P57075

WEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIP