GFER Fragment MS Protein Standard

Product Information
Protein Name
FAD-linked sulfhydryl oxidase ALR
Symbol
GFER
Synonyms
Augmenter of liver regeneration, Hepatopoietin
Uniprot ID
P55789
Description
GFER Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GFER protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket