AGFG1 Fragment MS Protein Standard

Arf-GAP domain and FG repeat-containing protein 1

AGFG1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human AGFG1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

AGFG1

HIV-1 Rev-binding protein, Nucleoporin-like protein RIP, Rev-interacting protein, Rev/Rex activation domain-binding protein

P52594

PQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAG