BMX Fragment MS Protein Standard

Cytoplasmic tyrosine-protein kinase BMX

BMX Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BMX protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BMX

Bone marrow tyrosine kinase gene in chromosome X protein, Epithelial and endothelial tyrosine kinase, NTK38

P51813

KFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVR