IDH3G Fragment MS Protein Standard

Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

IDH3G Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human IDH3G protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

IDH3G

Isocitric dehydrogenase subunit gamma, NAD(+)-specific ICDH subunit gamma

P51553

FDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVI