TAF6 Fragment MS Protein Standard

Transcription initiation factor TFIID subunit 6

TAF6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAF6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TAF6

RNA polymerase II TBP-associated factor subunit E, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit

P49848

LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!