MASP1 Fragment MS Protein Standard

Product Information
Protein Name
Mannan-binding lectin serine protease 1
Description
MASP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MASP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
MASP1
Synonyms
Complement factor MASP-3, Complement-activating component of Ra-reactive factor, Mannose-binding lectin-associated serine protease 1, Mannose-binding protein-associated serine protease, Ra-reactive factor serine protease p100, Serine protease 5
Uniprot ID
P48740
Product Sequence
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket