LSS Fragment MS Protein Standard

Lanosterol synthase

LSS Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human LSS protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

LSS

2,3-epoxysqualene--lanosterol cyclase, Oxidosqualene--lanosterol cyclase

P48449

IQALLEAGGHHRPEFSSCLQKAHEFLRLSQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPRERLCDAVAVLLNMR