GGT5 Fragment MS Protein Standard

Gamma-glutamyltransferase 5

GGT5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GGT5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GGT5

Gamma-glutamyl transpeptidase-related enzyme, Gamma-glutamyltransferase-like activity 1, Gamma-glutamyltranspeptidase 5, Glutathione hydrolase 5, Leukotriene-C4 hydrolase

P36269

GTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!