DDIT3 Fragment MS Protein Standard

DNA damage-inducible transcript 3 protein

DDIT3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DDIT3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DDIT3

C/EBP zeta, C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, Growth arrest and DNA damage-inducible protein GADD153

P35638

QSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERL