FMO3 Fragment MS Protein Standard

Dimethylaniline monooxygenase [N-oxide-forming] 3

FMO3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FMO3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FMO3

Dimethylaniline oxidase 3, FMO II, FMO form 2, Hepatic flavin-containing monooxygenase 3, Trimethylamine monooxygenase

P31513

FEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINE