CORO1A Fragment MS Protein Standard

Coronin-1A

CORO1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CORO1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CORO1A

Coronin-like protein A, Coronin-like protein p57, Tryptophan aspartate-containing coat protein

P31146

RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA