EPHA8 Fragment MS Protein Standard

Ephrin type-A receptor 8

EPHA8 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EPHA8 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EPHA8

EPH- and ELK-related kinase, EPH-like kinase 3, Tyrosine-protein kinase receptor EEK

P29322

ISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIE