GLDC Fragment MS Protein Standard

Glycine dehydrogenase (decarboxylating), mitochondrial

GLDC Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GLDC protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GLDC

Glycine cleavage system P protein, Glycine decarboxylase, Glycine dehydrogenase (aminomethyl-transferring)

P23378

SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMK