UQCRC2 Fragment MS Protein Standard

Cytochrome b-c1 complex subunit 2, mitochondrial

UQCRC2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UQCRC2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UQCRC2

Complex III subunit 2, Core protein II, Ubiquinol-cytochrome-c reductase complex core protein 2

P22695

IKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFR