TNFAIP3 Fragment MS Protein Standard

Tumor necrosis factor alpha-induced protein 3

TNFAIP3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TNFAIP3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TNFAIP3

OTU domain-containing protein 7C, Putative DNA-binding protein A20, Zinc finger protein A20

P21580

QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAK