POLR2C Fragment MS Protein Standard

DNA-directed RNA polymerase II subunit RPB3

POLR2C Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human POLR2C protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

POLR2C

DNA-directed RNA polymerase II 33 kDa polypeptide, DNA-directed RNA polymerase II subunit C, RPB31

P19387

VEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPD