FER Fragment MS Protein Standard

Tyrosine-protein kinase Fer

FER Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FER protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FER

Feline encephalitis virus-related kinase FER, Fujinami poultry sarcoma/Feline sarcoma-related protein Fer, Proto-oncogene c-Fer, Tyrosine kinase 3, p94-Fer

P16591

QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQ