NQO1 Fragment MS Protein Standard

NAD(P)H dehydrogenase [quinone] 1

NQO1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NQO1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NQO1

Azoreductase, DT-diaphorase, Menadione reductase, NAD(P)H:quinone oxidoreductase 1, Phylloquinone reductase, Quinone reductase 1

P15559

FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!