GZMB Fragment MS Protein Standard

Product Information
Protein Name
Granzyme B
Description
GZMB Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GZMB protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
GZMB
Synonyms
C11, CTLA-1, Cathepsin G-like 1, Cytotoxic T-lymphocyte proteinase 2, Fragmentin-2, Granzyme-2, Human lymphocyte protein, SECT, T-cell serine protease 1-3E
Uniprot ID
P10144
Product Sequence
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket