CD3G Fragment MS Protein Standard

T-cell surface glycoprotein CD3 gamma chain

CD3G Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CD3G protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CD3G

T-cell receptor T3 gamma chain

P09693

GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN