RPSA Fragment MS Protein Standard

Product Information
Protein Name
40S ribosomal protein SA
Description
RPSA Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RPSA protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
RPSA
Synonyms
37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 67 kDa laminin receptor, Colon carcinoma laminin-binding protein, Laminin receptor 1, Laminin-binding protein precursor p40, Multidrug resistance-associated protein MGr1-Ag, NEM/1CHD4
Uniprot ID
P08865
Product Sequence
RLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHP

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket