FCER2 Fragment MS Protein Standard

Low affinity immunoglobulin epsilon Fc receptor

FCER2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human FCER2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

FCER2

BLAST-2, C-type lectin domain family 4 member J, Fc-epsilon-RII, Immunoglobulin E-binding factor, Lymphocyte IgE receptor

P06734

VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP