CDK1 Fragment MS Protein Standard

Cyclin-dependent kinase 1

CDK1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CDK1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CDK1

Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase

P06493

LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM