TFF1 Fragment MS Protein Standard

Product Information
Protein Name
Trefoil factor 1
Description
TFF1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TFF1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
TFF1
Synonyms
Breast cancer estrogen-inducible protein, PNR-2, Polypeptide P1.A, Protein pS2
Uniprot ID
P04155
Product Sequence
QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket