ACTL6A Fragment MS Protein Standard

Product Information
Protein Name
Actin-like protein 6A
Description
ACTL6A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ACTL6A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
ACTL6A
Synonyms
53 kDa BRG1-associated factor A, Actin-related protein Baf53a, ArpNbeta, BRG1-associated factor 53A, INO80 complex subunit K
Uniprot ID
O96019
Product Sequence
FPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRV

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket