DDAH2 Fragment MS Protein Standard

N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

DDAH2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DDAH2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DDAH2

DDAHII, Dimethylargininase-2, Protein G6a, S-phase protein

O95865

ESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEI