DIRAS3 Fragment MS Protein Standard

GTP-binding protein Di-Ras3

DIRAS3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human DIRAS3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

DIRAS3

Distinct subgroup of the Ras family member 3, Rho-related GTP-binding protein RhoI

O95661

YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF