RAPGEF3 Fragment MS Protein Standard

Rap guanine nucleotide exchange factor 3

RAPGEF3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human RAPGEF3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

RAPGEF3

Exchange factor directly activated by cAMP 1, Exchange protein directly activated by cAMP 1, Rap1 guanine-nucleotide-exchange factor directly activated by cAMP, cAMP-regulated guanine nucleotide exchange factor I

O95398

TYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQ