GADD45G Fragment MS Protein Standard

Growth arrest and DNA damage-inducible protein GADD45 gamma

GADD45G Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GADD45G protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

GADD45G

Cytokine-responsive protein CR6, DNA damage-inducible transcript 2 protein

O95257

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVG