SOGA1 Fragment MS Protein Standard

Product Information
Protein Name
Protein SOGA1
Description
SOGA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SOGA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SOGA1
Synonyms
SOGA family member 1, Suppressor of glucose by autophagy, Suppressor of glucose, autophagy-associated protein 1
Uniprot ID
O94964
Product Sequence
LPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket