TOMM70A Fragment MS Protein Standard

Mitochondrial import receptor subunit TOM70

TOMM70A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TOMM70A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TOMM70A

Mitochondrial precursor proteins import receptor, Translocase of outer membrane 70 kDa subunit

O94826

PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYD