SNRNP200 Fragment MS Protein Standard

U5 small nuclear ribonucleoprotein 200 kDa helicase

SNRNP200 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SNRNP200 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SNRNP200

Activating signal cointegrator 1 complex subunit 3-like 1, BRR2 homolog, U5 snRNP-specific 200 kDa protein

O75643

LHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!