SKAP2 Fragment MS Protein Standard

Product Information
Protein Name
Src kinase-associated phosphoprotein 2
Description
SKAP2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SKAP2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SKAP2
Synonyms
Pyk2/RAFTK-associated protein, Retinoic acid-induced protein 70, SKAP55 homolog, Src family-associated phosphoprotein 2, Src kinase-associated phosphoprotein 55-related protein, Src-associated adapter protein with PH and SH3 domains
Uniprot ID
O75563
Product Sequence
LPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDH

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket