WBP4 Fragment MS Protein Standard

WW domain-binding protein 4

WBP4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human WBP4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

WBP4

Formin-binding protein 21, WW domain-containing-binding protein 4

O75554

SDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQ