KHDRBS3 Fragment MS Protein Standard

KH domain-containing, RNA-binding, signal transduction-associated protein 3

KHDRBS3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human KHDRBS3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

KHDRBS3

RNA-binding protein T-Star, Sam68-like mammalian protein 2, Sam68-like phosphotyrosine protein

O75525

GEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARM