ATP6V1G1 Fragment MS Protein Standard

V-type proton ATPase subunit G 1

ATP6V1G1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ATP6V1G1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ATP6V1G1

V-ATPase 13 kDa subunit 1, Vacuolar proton pump subunit G 1, Vacuolar proton pump subunit M16

O75348

AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR