NOS1AP Fragment MS Protein Standard

Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein

NOS1AP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NOS1AP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NOS1AP

C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein

O75052

HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVK