EIF4E2 Fragment MS Protein Standard

Product Information
Protein Name
Eukaryotic translation initiation factor 4E type 2
Description
EIF4E2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EIF4E2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
EIF4E2
Synonyms
Eukaryotic translation initiation factor 4E homologous protein, Eukaryotic translation initiation factor 4E-like 3, eIF4E-like protein 4E-LP, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3
Uniprot ID
O60573
Product Sequence
TERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2024 Creative Proteomics. All rights reserved.
2
Inquiry Basket