TNFSF12 Fragment MS Protein Standard

Product Information
Protein Name
Tumor necrosis factor ligand superfamily member 12
Symbol
TNFSF12
Synonyms
APO3 ligand, TNF-related weak inducer of apoptosis
Uniprot ID
O43508
Description
TNFSF12 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TNFSF12 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket