PRKRIR Fragment MS Protein Standard

52 kDa repressor of the inhibitor of the protein kinase

PRKRIR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human PRKRIR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

PRKRIR

58 kDa interferon-induced protein kinase-interacting protein, Death-associated protein 4, THAP domain-containing protein 0

O43422

NLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSE