EEF1E1 Fragment MS Protein Standard

Eukaryotic translation elongation factor 1 epsilon-1

EEF1E1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human EEF1E1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

EEF1E1

Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, Elongation factor p18, Multisynthase complex auxiliary component p18

O43324

LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL