NDUFS4 Fragment MS Protein Standard

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

NDUFS4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human NDUFS4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

NDUFS4

Complex I-18 kDa, Complex I-AQDQ, NADH-ubiquinone oxidoreductase 18 kDa subunit

O43181

RSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVS