ASAP2 Fragment MS Protein Standard

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

ASAP2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ASAP2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ASAP2

Development and differentiation-enhancing factor 2, Paxillin-associated protein with ARF GAP activity 3, Pyk2 C-terminus-associated protein

O43150

RNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTNPLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRP