GRIN2D Fragment MS Protein Standard

Product Information
Protein Name
Glutamate receptor ionotropic, NMDA 2D
Symbol
GRIN2D
Synonyms
EB11, Glutamate [NMDA] receptor subunit epsilon-4, N-methyl D-aspartate receptor subtype 2D
Uniprot ID
O15399
Description
GRIN2D Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human GRIN2D protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Product Sequence
LHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVD

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

Related Products
Copyright © 2021 Creative Proteomics. All rights reserved.
2
Inquiry Basket