MAP2K7 Fragment MS Protein Standard

Dual specificity mitogen-activated protein kinase kinase 7

MAP2K7 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human MAP2K7 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

MAP2K7

JNK-activating kinase 2, MAPK/ERK kinase 7, Stress-activated protein kinase kinase 4, c-Jun N-terminal kinase kinase 2

O14733

RHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVK