CTDSP2 Fragment MS Protein Standard

Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2

CTDSP2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human CTDSP2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

CTDSP2

Nuclear LIM interactor-interacting factor 2, Protein OS-4, Small C-terminal domain phosphatase 2, Small CTD phosphatase 2

O14595

CCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVID