BHLHE40 Fragment MS Protein Standard

Class E basic helix-loop-helix protein 40

BHLHE40 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human BHLHE40 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

BHLHE40

Class B basic helix-loop-helix protein 2, Differentially expressed in chondrocytes protein 1, Enhancer-of-split and hairy-related protein 2, Stimulated by retinoic acid gene 13 protein

O14503

GRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQ