ARID1A Fragment MS Protein Standard

AT-rich interactive domain-containing protein 1A

ARID1A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ARID1A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ARID1A

B120, BRG1-associated factor 250, BRG1-associated factor 250a, Osa homolog 1, SWI-like protein, SWI/SNF complex protein p270, SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1, hELD

O14497

PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK